Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00154.1.g00170.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 278aa    MW: 30606.2 Da    PI: 5.188
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                 Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                    rg+WT+eEd +l++ +   G  +W+++++  g+ R++k+c++rw +yl 14 RGPWTAEEDRKLINFILTNGHCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                                    89******************************99************97 PP

                 Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                      T  E++  +d++++lG++ W++Ia++++ gRt++++k++w+++  70 LTDAEEQVVIDLHAKLGNR-WSKIAAKLP-GRTDNEIKNHWNTH 111
                                     5899***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.085961IPR017930Myb domain
SMARTSM007172.3E-121363IPR001005SANT/Myb domain
PfamPF002493.5E-141461IPR001005SANT/Myb domain
CDDcd001671.39E-91661No hitNo description
PROSITE profilePS5129427.53662116IPR017930Myb domain
SMARTSM007172.5E-1466114IPR001005SANT/Myb domain
PfamPF002498.3E-1470111IPR001005SANT/Myb domain
CDDcd001672.09E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957458.11e-153PREDICTED: protein ODORANT1-like
SwissprotQ50EX65e-99ODO1_PETHY; Protein ODORANT1
TrEMBLK3ZVW91e-152K3ZVW9_SETIT; Uncharacterized protein
STRINGSi030750m1e-152(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number